SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015065 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015065
Domain Number 1 Region: 488-678
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.2e-55
Family acyl-CoA oxidase C-terminal domains 0.0000137
Further Details:      
 
Domain Number 2 Region: 20-280
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.96e-48
Family acyl-CoA oxidase N-terminal domains 0.00000245
Further Details:      
 
Domain Number 3 Region: 303-460
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.79e-48
Family acyl-CoA oxidase C-terminal domains 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015065   Gene: ENSGGOG00000015441   Transcript: ENSGGOT00000015496
Sequence length 684
Comment pep:known_by_projection chromosome:gorGor3.1:3:59998460:60029908:-1 gene:ENSGGOG00000015441 transcript:ENSGGOT00000015496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHS
YPEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIH
RVFVRALRSLGSEEQIAKWDPLCKNIQIITTYAQTELGHGTYLQGLETEATYDAATQEFV
IHSPTLTATKWWPGDLGRSATHALVQAQLICSGARRGMHAFIVPIRSLQDHTPLPGIITG
DIGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVE
LLSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHF
LAVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSK
LSGLPSLVTKLLASCTYEGENTVLYLQVARFLVKSYLQTQMSPGSTPQRSLPPSVAYLTA
PDLARCPAQRAADFLCPELYTTAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIH
LQAAKAHCYYVTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSG
AQVDMARTAYLDLLHLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTN
TQKQENPAYEEYIRPLLQSWRSKL
Download sequence
Identical sequences ENSGGOP00000015065 ENSGGOP00000015065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]