SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015282 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015282
Domain Number 1 Region: 200-380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-27
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 2 Region: 29-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-23
Family Laminin G-like module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015282   Gene: ENSGGOG00000015661   Transcript: ENSGGOT00000015718
Sequence length 2322
Comment pep:known_by_projection chromosome:gorGor3.1:15:55297097:55337457:-1 gene:ENSGGOG00000015661 transcript:ENSGGOT00000015718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATAVTNIDLQLQFSTSQP
EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLASFPAWGTQDEGTLEFTLTTQSRQAPLA
FQAGGRRGDFIFVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVSMPSCLRRGQTY
LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSTCEGLTFQVLGTSSG
LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRITGALQFGELQKQGAGGV
EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHTDDTMENLALEVQVGQEILSNLSFPVTIQ
RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYSFPIHIGGDPDAP
VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWLGTQDKTTMVTSF
TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
GQGTIDTAVLHLDTNLDIRSGDEVHYHITAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
HNGSLSPRDTLAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEALDTGRVLY
LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWREVEEQLIRYVHDGSETL
TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPVEALRST
DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGRLVLFSHRGTLDGGFRFRL
SDGEHTSSGHFFRVMAQKQVLLSLEGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
QRPEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTHFTQADVDSGRLAFVANGSSVAGIFQLS
MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
LIQGPQYGHLLVGGRPASAFSQLQIDQGDVVFAFTNFSSSHDHFRVLALARGVNASAVVN
VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV
Download sequence
Identical sequences ENSGGOP00000015282 ENSGGOP00000017173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]