SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015356 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015356
Domain Number 1 Region: 892-1073
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1048-1169
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 3 Region: 191-221,312-441
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015356
Domain Number - Region: 1173-1260
Classification Level Classification E-value
Superfamily Tropomyosin 0.0647
Family Tropomyosin 0.008
Further Details:      
 
Domain Number - Region: 436-497
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0706
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015356   Gene: ENSGGOG00000015734   Transcript: ENSGGOT00000015795
Sequence length 1299
Comment pep:known_by_projection chromosome:gorGor3.1:13:57959034:58163020:-1 gene:ENSGGOG00000015734 transcript:ENSGGOT00000015795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHMHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGR
AQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQN
SGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIFLRV
ASPINKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVIFLSGEDDPEKIEERKKSKELR
SLWRKAIHQQILLLRMEKENQKLEVASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLN
CRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQL
TAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLL
LHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEIS
PSLYAAPWFLTLFASQFSLGFVARVFDTIFLQGTEVIFKVALSLLSSQETLIMECESFEN
IVEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSEPL
EKLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQ
KTVEQLRKLLPADALASCDLLLRDLNCNPNNKAKIGNKP
Download sequence
Identical sequences ENSGGOP00000015356 ENSGGOP00000015356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]