SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015473 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015473
Domain Number 1 Region: 141-322
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.08e-60
Family Brix domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015473   Gene: ENSGGOG00000015862   Transcript: ENSGGOT00000015918
Sequence length 349
Comment pep:known_by_projection chromosome:gorGor3.1:1:86756961:86777443:1 gene:ENSGGOG00000015862 transcript:ENSGGOT00000015918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGDKSSSGGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPND
EEVAYDEATDEFASYFNKQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCIARDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFRSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences G3RIH1
ENSGGOP00000015473 XP_004026097.1.27298 ENSGGOP00000015473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]