SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015523 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015523
Domain Number 1 Region: 211-265
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000254
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015523   Gene: ENSGGOG00000015912   Transcript: ENSGGOT00000015968
Sequence length 293
Comment pep:known_by_projection chromosome:gorGor3.1:19:588299:605198:-1 gene:ENSGGOG00000015912 transcript:ENSGGOT00000015968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPGPWGVLHSNPMD
YAWGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYAL
GERVRQLPCNHLFHDGCIVPWLEQVSAPPTRFSSSSSSSSSSSPSNENATSNS
Download sequence
Identical sequences ENSGGOP00000015523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]