SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015536 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015536
Domain Number 1 Region: 125-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000867
Family Ubiquitin-related 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015536   Gene: ENSGGOG00000015921   Transcript: ENSGGOT00000015981
Sequence length 790
Comment pep:known_by_projection chromosome:gorGor3.1:7:121506448:121567411:-1 gene:ENSGGOG00000015921 transcript:ENSGGOT00000015981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQQKYETQNIANSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVE
EQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQFAMQRPNDDSLAFLDKIKSVKES
LQESMENSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQVRYSGKIL
KNNETLVQHGVNPQEIVQVEIFSTNPDLFPVRRIDGLTDVSQIITVTVQTGLDQYQQVPV
EIVKSDFHKPFLGGFRHKITGVEYHNAGTQTVPKRIPERLSIFCRDTQTVFQKKNLQQTT
NTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYRQWHAKIFVENL
RRQKSLRLEWETQQELRKIREKEEWIKLDYHRRHNPKTNEDFEFLYNALEFWRQEELTRI
NQSFTGAERKAALCELLEKETQIIASIGRHRYVAYMANQEAAIQAFLDKCSAPKIWRTPN
GKTIEMDTQFTIRARELQNIYKCIMLKNISQDERLDVLLTLKHTVKEHECKLTQEILELI
DREVDLMMRGVKHHNLEGLRKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFYKKIYFC
HSCQLYLPSTEFSVSSTSRRIYRCRNCISLQNEAQKRESFLKYKCLLQQLYYTEADYEDD
SKIAFLMQLQDIQYLTENIWASRSVLSACDNLSDLVMVRWNKSLEWSPWNCILLTKDEAA
AHLKLTSIEEGYERSFIHKIKHKHILAKNYFSQVPVLASFILDDGEIDEIRWKYHSDTTP
KIIESQRPPH
Download sequence
Identical sequences G3RIM6
XP_004046181.1.27298 ENSGGOP00000015536 ENSGGOP00000015536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]