SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015568 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015568
Domain Number 1 Region: 128-327
Classification Level Classification E-value
Superfamily L domain-like 8.26e-29
Family Ngr ectodomain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015568   Gene: ENSGGOG00000015966   Transcript: ENSGGOT00000016015
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:1:183490258:183499679:1 gene:ENSGGOG00000015966 transcript:ENSGGOT00000016015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ
PNHAGPGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLT
KLKRIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSG
IQPAAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRAVHLQNNLIETMQRDVFCDPEEHKHT
RRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
Download sequence
Identical sequences ENSGGOP00000015568 ENSGGOP00000015568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]