SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015587 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015587
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000127
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015587   Gene: ENSGGOG00000003764   Transcript: ENSGGOT00000016035
Sequence length 509
Comment pep:novel chromosome:gorGor3.1:19:23167246:23195450:-1 gene:ENSGGOG00000003764 transcript:ENSGGOT00000016035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGK
EPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYDKCGHENLQLKIGCTNV
DECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVR
SFCMLSHLSQHKRIHTGEKPYKCEQCGKAFNRSSILTKHKIIHTGEKPYKCEECGKAFNS
SSNLTEHKRVHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSSIL
TKHKIIHTGEKPYKCEECGKAFKWSSTLTKHKIIHTGEKPYKCEECGKAFTTFSSLTKHK
VIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLYKCEECGKAFKWSSNLMEHKRIHT
GEKPYKCEECGKAFSKVANLTKHKVIHTGEKPYKCEECGKAFIWSSRLSEHKRIHTGEKP
YKCEECGKAFSWVSVLNKHKKIHAGKKFY
Download sequence
Identical sequences ENSGGOP00000015587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]