SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015673 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015673
Domain Number 1 Region: 26-246
Classification Level Classification E-value
Superfamily t-snare proteins 2.59e-69
Family t-snare proteins 0.00000000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015673   Gene: ENSGGOG00000016069   Transcript: ENSGGOT00000016122
Sequence length 288
Comment pep:known_by_projection chromosome:gorGor3.1:16:31758903:31768678:-1 gene:ENSGGOG00000016069 transcript:ENSGGOT00000016122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRERVGELESAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
Download sequence
Identical sequences ENSGGOP00000020043 ENSGGOP00000015673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]