SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015839 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015839
Domain Number 1 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 21-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-24
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 6 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 183-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-18
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 8 Region: 476-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000871
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015839   Gene: ENSGGOG00000016237   Transcript: ENSGGOT00000016291
Sequence length 520
Comment pep:known_by_projection chromosome:gorGor3.1:19:33492472:33529706:-1 gene:ENSGGOG00000016237 transcript:ENSGGOT00000016291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCTCPREESREIRAGQIVLKAMAQGLVTFRDVAIEFSLEEWKCLEPAQRDLYREVTLENF
GHLASLGLSISKPDVVSLLEQGKEPWMIANDVTGPWCPDLESRCEKFLQKDIFEIRAFNW
EIMESLKCGDLEGSDFRADWECEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTVRQS
RETGEKLMECHECGKAFSRGSHLIQHQKTHTGEKPFGCKECGKAFSRASHLVQHQRIHTG
EKPYDCKDCGKAFGRTSELILHQRLHTGVKPYECKECGKTFRQHSQLILHQRTHTGEKPY
VCKDCGKAFIRGSQLTVHRRIHTGARPYECKECGKAFRQHSQLTVHQRIHTGEKPYECKE
CGKGFIHSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQRVHTGDRPYECKDCGKA
FSRSSYLIQHQRIHTGDKPYECKECGKAFIRVSQLTHHQRIHTCEKPYECRECGMAFIRS
SQLTEHQRIHPGIKPYECRECGQAFILGSQLIEHYRIHTG
Download sequence
Identical sequences ENSGGOP00000015839 ENSGGOP00000015839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]