SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016079
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 157-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016079   Gene: ENSGGOG00000001955   Transcript: ENSGGOT00000016537
Sequence length 444
Comment pep:known_by_projection chromosome:gorGor3.1:19:20972510:20993502:-1 gene:ENSGGOG00000001955 transcript:ENSGGOT00000016537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDFITCLEQGK
KPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESV
DECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGK
AFNQPSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKIIHTGEKPYKCEECGKAFKR
SSILTAHKIIHTGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSL
TTHKIIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFNWFSILTTHK
RIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKPYKCERCGKAFKRSFILTRHKRIHT
GEKPYKVKNVAKALSAPLPLLHIR
Download sequence
Identical sequences ENSGGOP00000016079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]