SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016093 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016093
Domain Number 1 Region: 178-264
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 440-510
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000177
Further Details:      
 
Domain Number 3 Region: 66-142
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016093   Gene: ENSGGOG00000016495   Transcript: ENSGGOT00000016551
Sequence length 524
Comment pep:known_by_projection chromosome:gorGor3.1:14:7461219:7679151:-1 gene:ENSGGOG00000016495 transcript:ENSGGOT00000016551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNKRENLLPVAAAGTANMMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTN
TGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQ
GTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPS
DPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTV
SGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAA
AAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATG
ALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAAS
PLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEF
VPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Download sequence
Identical sequences F7IKG0
ENSGGOP00000016093 ENSCJAP00000011486 ENSCJAP00000011492 ENSGGOP00000016093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]