SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016137 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000016137
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016137   Gene: ENSGGOG00000016542   Transcript: ENSGGOT00000016596
Sequence length 219
Comment pep:known_by_projection chromosome:gorGor3.1:9:33929320:33945979:1 gene:ENSGGOG00000016542 transcript:ENSGGOT00000016596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
Download sequence
Identical sequences A0A0D9RC66 A0A2I3FQA2 A0A2J8XIU5 A0A2K5HF94 A0A2K5NZR9 A0A2K5YUB5 A0A2K6CTZ4 F6TSB3 G3RK77 G7PS50 H2QX51 Q5RBR3 Q9NZZ3
gi|189409150|ref|NP_057494.3| ENSPTRP00000035664 ENSPTRP00000035664 ENSP00000223500 GO.42278 ENSNLEP00000006287 ENSPPYP00000021442 ENSP00000223500 9544.ENSMMUP00000026530 9600.ENSPPYP00000021442 9606.ENSP00000223500 ENSP00000223500 ENSPPYP00000021442 ENSGGOP00000016137 ENSGGOP00000016137 ENSNLEP00000006287 NP_001125453.1.23681 NP_001253497.1.72884 NP_057494.3.87134 NP_057494.3.92137 XP_001154646.2.37143 XP_003830167.1.60992 XP_004047971.1.27298 XP_005581585.1.63531 XP_007967192.1.81039 XP_011746297.1.29376 XP_011781930.1.43180 XP_011835404.1.47321 XP_011924688.1.92194 ENSMMUP00000026530 ENSMMUP00000026530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]