SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016301 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016301
Domain Number 1 Region: 1496-1722
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.34e-42
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 644-748
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-29
Family Cadherin 0.00051
Further Details:      
 
Domain Number 3 Region: 539-651
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 955-1067
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.00091
Further Details:      
 
Domain Number 5 Region: 322-425
Classification Level Classification E-value
Superfamily Cadherin-like 3e-25
Family Cadherin 0.00094
Further Details:      
 
Domain Number 6 Region: 852-954
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 1739-1949
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-24
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 8 Region: 1061-1161
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 9 Region: 427-537
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 750-850
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 11 Region: 1435-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000223
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 1163-1265
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000628
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1983-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1947-1981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000024
Family EGF-type module 0.024
Further Details:      
 
Domain Number 15 Region: 2077-2116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016301
Domain Number - Region: 2538-2781
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000421
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number - Region: 2105-2179
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00288
Family Hormone receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 1414-1440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00779
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016301   Gene: ENSGGOG00000016683   Transcript: ENSGGOT00000016763
Sequence length 3289
Comment pep:known_by_projection chromosome:gorGor3.1:3:49883519:49908559:-1 gene:ENSGGOG00000016683 transcript:ENSGGOT00000016763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGA
LALCPESSGVREDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPSGS
RERETGQGPGSVLYWRSEVSSCGRTGPLQRGSLSPGALSSGVPGLGNSSPLPSDFLVRHH
GPKLVSSQRNAGTGSRKRVGTARCCGELWATGSKGQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRGLFRRRFLPQRPGPRPPGLPA
RPEARKITSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGQVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPVGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSFQVMVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAAVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCY
SNPCRNGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCTDAPNGGFRC
QCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQQSGLLFYNGRLNE
KHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQ
GPSKDKVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLP
ENFPVSHKDFIGCMRDLHIDGRRVDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCLER
WGGFSCDCPVGFGGKDCRLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQG
VLMQVQAGPHSTLLCQLDRGLLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPG
GRRGHHVLMVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPGSAEEAPQGLVGCIQGVW
LGSTPSGSPALLPPSHRVNVEPGCVVTNACASGPCPPHADCRDHWQTFSCTCRPGYYGPG
CVDACLLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPC
NCDVHKGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRP
GALGRQCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGILATVPCPRGALGAA
VRLCDEAQGWLEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREVTGHTD
HYFSQDVRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAAL
GQRAPGGSPGSAGLVRHLEEYAATLARNMELTYLNPMGLVTPNIMLSIDRMEHPSSPRGA
RRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPTSSSTENSTTSSVVPPPAPPE
PEPGISIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGILE
SPISLEFRLLQTANRSKAICVQWDPPGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTF
GVLMDASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAVLLSLRSLKSNVRGIHANVAA
ALGVAELLFLLGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPRNVDRG
AMRFYHALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIVMNGTM
FLLAARTSCSTGQREAKKTSALTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLC
GLQGLAVLLLFCVLNADARAAWTPACLGRKAAPEEARPAPGMGPGAYNNTALFEESGLIR
ITLGASTVSSVSSTRSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLD
VAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLCRAAQSERLLTHP
KDVDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDPALTSGDETSL
GRAQRQRKGILKNRLQYPLVPQTRGAPELSWCRAATLGPPSRYSSREQLDLLLRRQLSRE
RLEEAPAPVLRPLSRPGSQECMDAAPGRLEPRDRGSTLPRRQPPRDYPGAMAGRFGSRDA
LDLGAPREWLSTLPPPRRTRDLDPQPPPLPLSPQRQLSRDPLLPSRPLDSLSRSSNSREQ
LDQVPSRHPSREALGPPPQLLRAREDPVSGPSHGPSTEQLDILSSILASFNSSALSSVQS
SSTPLGPHTTATPSATASVLGPSTPRSATSHSISELSPDSEVPRSEGHS
Download sequence
Identical sequences ENSGGOP00000018010 ENSGGOP00000016301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]