SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016328 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016328
Domain Number 1 Region: 930-991
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000042
Family RING finger domain, C3HC4 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016328
Domain Number - Region: 241-373
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000201
Family Hemolysin E (HlyE, ClyA, SheA) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016328   Gene: ENSGGOG00000016728   Transcript: ENSGGOT00000016792
Sequence length 1001
Comment pep:known_by_projection chromosome:gorGor3.1:16:31525941:31538876:1 gene:ENSGGOG00000016728 transcript:ENSGGOT00000016792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLA
ERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSS
APEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELE
LQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQARTRELGRENRRL
QDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHL
AEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAEL
QGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATK
NSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPIN
REMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGL
SAPAPGKEEGGPGPVSTPDNRKEMAPVPGTTTTTTSVKKEELVPSEEDFQGVTPGAQGPS
SRGREPEARPKRELREREGPGLGPPPVASTLSRADREKAKVEETKRKESELLKGLRAELK
KAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRELEERDRRESKK
IADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQLR
EKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQG
SLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREK
ESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVL
TKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYIS
Download sequence
Identical sequences G3RKQ1
XP_018867664.1.27298 XP_018867665.1.27298 ENSGGOP00000016328 ENSGGOP00000016328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]