SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016362 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016362
Domain Number 1 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-18
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016362
Domain Number - Region: 129-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000529
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016362   Gene: ENSGGOG00000016775   Transcript: ENSGGOT00000016826
Sequence length 632
Comment pep:known_by_projection chromosome:gorGor3.1:19:32214336:32224906:-1 gene:ENSGGOG00000016775 transcript:ENSGGOT00000016826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRDPAQGCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCRGTEGKDLPSEHNVSVEGVAQDR
SPEATLCPQKTCPCDICGLRLKDILHLAEYQTAHPRQKPFVCEAYVKGSEFSANLPQKQV
QQNVHNPIRREEGQASPVKTCGDHTSNQLSTCREGGKDFVATAGFLQCEVTPSNGEPHKA
TEGVVDFHIALRHNKYYESGDAFNDESTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
LKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLNNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSMENVLLPCSQH
TPEISSENRPYQGAVNYKLKLVHPSTHPGEVP
Download sequence
Identical sequences G3RKT2
ENSGGOP00000016362 XP_004060539.2.27298 ENSGGOP00000016362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]