SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016473 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016473
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 336-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000748
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 435-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000001
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 269-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000409
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016473   Gene: ENSGGOG00000016885   Transcript: ENSGGOT00000016938
Sequence length 579
Comment pep:known_by_projection chromosome:gorGor3.1:10:41256496:41285282:-1 gene:ENSGGOG00000016885 transcript:ENSGGOT00000016938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKI
EQGEEPWILEKGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKTVSVENGDRGS
KTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRH
EKIPIGEKSYKYDQKRNAINYHQDLSQTSFGQSFEYSKNGQGFHDEAALFTNKRSQIGET
VCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFGHQRALTKDNPYEYN
EYGEIFCDSSAFIIHQGAYTRKILREYKVSDKTWEKSALLKHQIVHMGGKSYDYNENRSN
FSKKSHLTQLRRAHTGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK
PHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALT
VHQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQR
THTGEKPYECNACGKTFSQRSVLTKHQRIHTRVKALSTS
Download sequence
Identical sequences G3RL37
XP_004049326.1.27298 XP_004049327.1.27298 ENSGGOP00000016473 ENSGGOP00000016473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]