SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016496 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016496
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000553
Family S100 proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016496   Gene: ENSGGOG00000016907   Transcript: ENSGGOT00000016961
Sequence length 104
Comment pep:known_by_projection chromosome:gorGor3.1:1:132588876:132590908:-1 gene:ENSGGOG00000016907 transcript:ENSGGOT00000016961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPS
NCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGR
Download sequence
Identical sequences H2R1X6
ENSPTRP00000043054 XP_001139808.1.37143 XP_003817203.1.60992 XP_003817206.1.60992 XP_003949611.1.37143 ENSGGOP00000016496 ENSGGOP00000016496 ENSPTRP00000043054 9598.ENSPTRP00000043054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]