SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016640 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016640
Domain Number 1 Region: 110-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016640   Gene: ENSGGOG00000017054   Transcript: ENSGGOT00000017108
Sequence length 272
Comment pep:known_by_projection chromosome:gorGor3.1:4:121951284:121953940:-1 gene:ENSGGOG00000017054 transcript:ENSGGOT00000017108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARLQRGAEAG
QGARGGVAAGAEGCRPSRLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Download sequence
Identical sequences A0A2I2ZSF2
ENSGGOP00000016640 ENSGGOP00000016640 XP_004040346.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]