SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016705 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016705
Domain Number 1 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 639-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 416-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 135-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 10 Region: 22-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 11 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 12 Region: 192-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 98-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000684
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016705   Gene: ENSGGOG00000017119   Transcript: ENSGGOT00000017176
Sequence length 738
Comment pep:known_by_projection chromosome:gorGor3.1:19:34498464:34524426:-1 gene:ENSGGOG00000017119 transcript:ENSGGOT00000017176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWQHLDLSQRNLYRDVMLETY
SHLLSVGEKLWDHNQHRKIIGYKPASSQDQKIYSGENSYECAEFGKSFTWKSQFKVHLKV
PTGEKLYVCIECGRAFVQKPEFITHQKTHMREKPYKCNECGKSFFQVSSLFRHHRIHTGE
KLYECSECGKGFPYNSDLSIHEKIHTGERHHECTDCGKAFTQKSTLKIHQKIHTGERSYI
CIECGQAFIQKTQLIAHRRIHRGEKPYECNNCGKSFISKSQLQVHQRVHTRVKPYICTEY
GKVFSNNSNLITHKKVQSREKSSICTECGKAFTYRSELIIHQRIHTGEKPYECSECGKAF
TQKSALTVHQRIHTGEKSYICMKCGLAFIQKAHLIAHQIIHTGEKPYKCGHCGKLFTSKS
QLHVHKRIHTGEKPYMCNKCGKAFTNRSNLITHQKTHTGEKSYICSKCGKAFTQRSDLIT
HQRIHTGEKPYECNTCGKAFTQKSHLNIHQKIHTGERQYECHECGKAFNQKSILIVHQKI
HTGEKPYVCTECGRAFIRKSNFITHQRIHTGEKPYECSDCGKSFTSKSQLLVHQPIHTGE
KPYVCAECGKAFSGRSNLSKHQKTHTGEKPYICSECGKTFRQKSELITHHRIHTGEKPYE
CSDCGKSFTKKSQLQVHQRIHTGEKPYVCAECGKAFSNRSNLNKHQTTHTGDKPYKCGIC
GKGFVQKSVFSVHQSSHA
Download sequence
Identical sequences ENSGGOP00000016705 ENSGGOP00000016705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]