SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016780 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000016780
Domain Number - Region: 309-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0417
Family Galectin (animal S-lectin) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016780   Gene: ENSGGOG00000017194   Transcript: ENSGGOT00000017252
Sequence length 697
Comment pep:known_by_projection chromosome:gorGor3.1:7:110568782:110602985:-1 gene:ENSGGOG00000017194 transcript:ENSGGOT00000017252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKSLRYCFSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARINLLVAICLGLYVRWEKTA
NSLILVIFILGLFVLGIASILYYYFSMEAASLSLSNLWFGFLLGLLCFLDNSSFKNDVKE
ESTKYLLLTSIVLRILCSLVERISGYVRHRPTLLTTVEFLELVGFAIASTTMLVEKSLSV
ILLVVALAMLIIDLRMKSFLAIPNLVIFAVLLFFSSLETPKNPIAFACFFICLITDPFLD
IYFSGLSVTERWKPFLYRGRICRRLSVVFAGMIELTFFILSAFKLRDTHLWYFVIPGFSI
FGIFWMICHIIFLLTLWGFHTKLNDCHKVYFTHRTDYNSLDRIMASKGMRHFCLISEQLV
FFSLLATVILGAVSWQPTNGIFLSMFLIVLPLESMAHGLFHELGNCLGGTSVGYAIVIPT
NFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSK
LKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLTEWWREKNGSFCSRL
IIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSS
NNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAKHWMLHFPRITYPLVHLANWLCGL
NLFWICKTCFRCLKRLKMSWFLPTVLDTGQGFKLVKS
Download sequence
Identical sequences G3RLW8
ENSGGOP00000016780 ENSGGOP00000016780 XP_004046115.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]