SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016893 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016893
Domain Number 1 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 451-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 5 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 6 Region: 297-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000156
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 229-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000232
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 205-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000693
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016893   Gene: ENSGGOG00000022701   Transcript: ENSGGOT00000031172
Sequence length 588
Comment pep:novel chromosome:gorGor3.1:19:41675384:41684383:1 gene:ENSGGOG00000022701 transcript:ENSGGOT00000031172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFQERVIFKDVAVVFTKEELALLDKAQINLYQDVMLENFRNLMSVRDGIKNNILNLQE
KGLSYLLQEVLHCWQISKQRIQDLTGSQDYIMNLQEECSPHLNVSLCEECAGKSLQISEN
ENYIVNAIIKNQDITAWQSLTQVLTPESWRKANIMTEPQNSQGRYKGIYMEEKLYRHAQH
DDSLNWTSCDHHESQECKGEDPGRHPNCRKNFGMKSTVEQHNAVHVLPQPFPCNNCGVAF
ADDTDPHVHHSTHLGEKSYKCDQYGKNFSQSQDLIVHCKTHSGETPYEFHEWLMGCKQSS
DLPRYQKVPLGDKSYKCKECGKGFRCNSFLYNHHGVHTREMPYKCDACGKGFGFRLLLCI
HKGVHTGKKPYKSEECGKGFDQSLKLLVHQRVHAGEKPYKCSECGKCFSSSSVLQVHWRF
HTGEKPYRCGECGKGFSQSTHLHIHQRVHTGEKPYKCNVCGKDFVYSSVLHTHRIHTREK
PYKCEVCGKCFSYSSYFHLHQGDHTRERPYKCDECGKGFSRNSDLRVDLRVHTGERPYKC
KACGKGFSYNSYLLAHQRVHIDETKYTHCERGKDLPTHQILHKQRETL
Download sequence
Identical sequences ENSGGOP00000016893 ENSGGOP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]