SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016918 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016918
Domain Number 1 Region: 185-347
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-27
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016918
Domain Number - Region: 362-481
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00217
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016918   Gene: ENSGGOG00000005224   Transcript: ENSGGOT00000032559
Sequence length 1186
Comment pep:known_by_projection chromosome:gorGor3.1:9:119398212:119457982:1 gene:ENSGGOG00000005224 transcript:ENSGGOT00000032559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAKLPRSPSEEEPHGLSPLLPARGGGSVGSDVGQRLPVEDFSLDSSLSQVQVEFYVNE
NTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDDPALGIGCWGCPKQNYS
FNDSSSEINWAPILWVERKMTLWAIQVIVAIISFLETMLLIYLSYKGVPTLPRLPKLFWP
PLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMSNQVLILFCTLLCLVFTGTCGI
QHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIWPSQLLVVIMICVALVVLPLQFEEL
VYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCP
TEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAADH
QTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLALNCICPATSTL
ITLLVHTSRGQEGQESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKSFTYAAFHAHK
KYGVCLIGLKREDNKSILLNPGPRHILAASDTCFYINITKEENSAFIFKQEEKRKKRAFS
GQGLHEGPARLPVHSIIASMGTVAMDLQGTEHRPTQSGGGGGGSKLALPTENGSGSRRPS
IAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHL
LPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFIVPLRAYYRSRK
ELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDKESTM
SAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRE
RENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTTPGSGYLCA
MKITEGDLWIRTYGRLFQKLCSSSAEIPIGIYRTESHVFSTSEPHDLRAQSQISVNVEDC
EDTREVKGPWGSRAGTGGSSQGRHTGGGDPAEHPLLRHKSLQWARRLSRKAPKQAGRAAA
TEWISQQRLSLYRRSERQELSELVKNRMKHLGLPTTGYDEMNDHQNTLSYVLINPPPDTR
LEPSDIVYLIRSDPLAHVASSSQSRKSSCSHKLSSCNPETRDETQL
Download sequence
Identical sequences ENSGGOP00000005127 ENSGGOP00000016918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]