SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016940 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016940
Domain Number 1 Region: 199-302
Classification Level Classification E-value
Superfamily BRCT domain 1.44e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.033
Further Details:      
 
Domain Number 2 Region: 60-185
Classification Level Classification E-value
Superfamily BRCT domain 1.71e-23
Family DNA ligase 0.099
Further Details:      
 
Domain Number 3 Region: 1270-1372
Classification Level Classification E-value
Superfamily BRCT domain 1.1e-20
Family BRCT domain 0.034
Further Details:      
 
Domain Number 4 Region: 911-1012
Classification Level Classification E-value
Superfamily BRCT domain 1.14e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.023
Further Details:      
 
Domain Number 5 Region: 613-743
Classification Level Classification E-value
Superfamily BRCT domain 2.09e-19
Family DNA ligase 0.03
Further Details:      
 
Domain Number 6 Region: 817-871
Classification Level Classification E-value
Superfamily Uteroglobin-like 0.0000256
Family Uteroglobin-like 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016940
Domain Number - Region: 555-634
Classification Level Classification E-value
Superfamily BRCT domain 0.000824
Family DNA ligase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016940   Gene: ENSGGOG00000007648   Transcript: ENSGGOT00000024802
Sequence length 1526
Comment pep:known_by_projection chromosome:gorGor3.1:3:133735704:133800130:-1 gene:ENSGGOG00000007648 transcript:ENSGGOT00000024802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRNDKEPFFVKFLKSSDNSKCFFKALESIKEFQSEEYLQIITEEEALKIKENDRSLYIC
DPFSGVVFDHLKKLGCRIVGPQVVIFCMHHQRCVPRAEYPVYNMVMSDVTISCTSLEKEK
REEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQ
EKKITRYTDINMEDFKCPIFLGCIICVTGLCGLDRKEVQQLTVKHGGQYMGQLKMNECTH
LIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKTEPRPESKTMPNSSTPT
SQINTIDSRTLSDVSNISNINASCISESICNSLNSKLEPTLENLENLDVSAFQAPEDLLD
GCRIFLRICSSNGGTLCKIEKMLESGFYFIMERTAVEHVSLFFYSSSLKFYWISSCFPSY
QQHIDIEKTLLESHSDSFLILWTLGNPKDGVNPYPFIIHVSFSFVSMVRIIRFHVTLISL
LGSKLYKVNCWLENIYFSLSVEAKTSEAEKSEFRPFNDSTHAEPLNDSTHISLQEENQSS
VSHCVPDVSTITEEGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVV
PLLGCEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQC
AGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAV
TIAWLLETARTGKRADESHFLIENSSKEERSLETEITNGINLNSDTAEHPGTRLQTHRKT
VVTPLDMNRFQSKAFRAVVSQHARQVAASPAVGQPLQKEPSLHLDTPSKFLSKDKLFKPS
FDVKDALAALETPGRPSQQKRKLSTPLSEVIVRNLQLALANSSRNAVALSASPQLKEAQS
EKEEAPKPLHKVVVCVSKKLGKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNR
EYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNPKMSLDISAVQDGRLCNSRLLS
AVSATKDDEPDPLILEENDVDNMATNNKESAPSNGNGKNDSKGVLTQTLEMRENFQKQLQ
EIMSATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTE
PSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLRDSEIAK
QAVCDPGNIRVTEAPKHPISEELETPIKDSHLIPTPQAPSIAFPLANPPVAPHPREKIIT
IEETHEELKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNE
KYLASVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMR
WRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATH
LFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNN
KELGTGLSQKRKAPTEKNKIKRPRVH
Download sequence
Identical sequences ENSGGOP00000007486 ENSGGOP00000016940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]