SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016953 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016953
Domain Number 1 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 19-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 471-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-17
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 336-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000018
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016953   Gene: ENSGGOG00000002655   Transcript: ENSGGOT00000033806
Sequence length 530
Comment pep:known_by_projection chromosome:gorGor3.1:19:49459318:49479750:-1 gene:ENSGGOG00000002655 transcript:ENSGGOT00000033806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTEREAQERKKKEKEPGMALPQGSLTFRDVAVEFSQEEWKCLDPVQKALYRDVMLENYR
NLGFLGLCLPDLNIISMLEQGKEPWTVVSQVKIARNPNCGECMKSVITGDVENKHMENQL
ILRFQSGLGELQKFQTAEKIYGCNQIERTVNNGFLASPLQRIFPGVQTNISRKYGNDFLQ
LSLPTQDEKTHIREKPYIGNECGKAFRVSSSLINHQMIHTTEKPYRCNESGKAFHRGSLL
TVHQIVHTRGKPYQCDVCGRIFRQNSDLVNHRRSHTGDKPYICNECGKSFSKSSHLAVHQ
RIHTGEKPYKCNRCGKCFSQSSSLATHQTVHTGDKPYKCNECGKTFKRNSSLTAHHMIHA
GKKPYTCDVCGKVFYQNSQLVRHQIIHTGETPYKCNECGKVFFQRSRLAGHRRIHTGEKP
YKCNECGKVFSQHSHLAVHQRVHTGEKPYKCNECGKAFNWGSLLTVHQRIHTGEKPYKCN
VCGKVFNYGGYLSVHMRCHTGEKPLHCNKCGMVFTYYSCLARHQRMHTGE
Download sequence
Identical sequences ENSGGOP00000016953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]