SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016957 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016957
Domain Number 1 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 36-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 399-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 237-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 161-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000227
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016957
Domain Number - Region: 212-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.015
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016957   Gene: ENSGGOG00000003326   Transcript: ENSGGOT00000030833
Sequence length 450
Comment pep:known_by_projection chromosome:gorGor3.1:16:79920115:79927121:1 gene:ENSGGOG00000003326 transcript:ENSGGOT00000030833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLAHGHVSRDSVCLHEEQTQAAGMVAGCLINCYQDSVTFDDVAVDFTQEEWTLLDP
SQRDLYRDVMLENYENLASVEATMEGSSVKCGEAFSEHSGLSTHVRTQNTGDSCVSNHYE
RDFFIPCQKTLFKIGEQFSVLGQCGKAFSPTPNVVARAGSHNGEGTYVCRECGKAFRYTA
YLTSRVQVHTGEKPCELEECGKASPVSSSLTQHVRIHAAEKSKQTKDCGKACGGFYLLNE
HGKTHTREKPFACVVCGKYFRNSSCLNNHVRIHTGIKPYVCKDCGKAFCTSSGLTEHVRT
HTGEKPYECKDCGKSFTVSSSLTEHARIHTGEKPYECKQCGKAFTGRSGLTKHTRTHTGE
KPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICMVCGKSFRNSSCLNKHIQIHTGIKPYE
CKDCGKTFTVSSSLTEHIRTHTGEKPYECK
Download sequence
Identical sequences ENSGGOP00000016957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]