SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017031 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017031
Domain Number 1 Region: 33-187
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.57e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 192-333
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.75e-27
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017031   Gene: ENSGGOG00000007990   Transcript: ENSGGOT00000025763
Sequence length 372
Comment pep:known_by_projection chromosome:gorGor3.1:12:47043836:47048493:-1 gene:ENSGGOG00000007990 transcript:ENSGGOT00000025763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIYCLLLLLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRV
ARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTE
GWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVK
ADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAVRPGGAHAVLLFLDRDLQRR
ASFVAVETEWPPRKLLLTPWHLVFAARGPARQATLHRCSRAGYAGDSVLAPGGDALRPAR
VARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHARGCSPAG
GMHWYSRLLYRL
Download sequence
Identical sequences ENSGGOP00000017031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]