SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017048 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017048
Domain Number 1 Region: 2-375
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.93e-118
Family Motor proteins 0.00000000745
Further Details:      
 
Domain Number 2 Region: 1676-1756
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.41e-29
Family Cap-Gly domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 436-530
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.23e-24
Family FHA domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017048
Domain Number - Region: 861-942
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0268
Family PLC-like (P variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017048   Gene: ENSGGOG00000000863   Transcript: ENSGGOT00000032663
Sequence length 1808
Comment pep:known_by_projection chromosome:gorGor3.1:8:29071993:29270315:-1 gene:ENSGGOG00000000863 transcript:ENSGGOT00000032663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARGQPKVFAYDHCFWSMDESVKEKYA
GQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQPGLIPRLCSGLFERT
QKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGNRSRQTLKVREHSVLGPYVDGLSKLAVT
SYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSGTSGEKVGKLSLV
DLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQSAGKNKNKFVPYRDSVLTW
LLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIVNHAVVNEDPNARIIRDLR
EEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEEIAQERQKQLESL
GISLQSSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEH
CIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLPKKKKKAE
REDEDQDPSMKNENSSEQLDVDGDSSSEVSSEINFNYEYAQMEVTMKALGSNDPMQSILN
SLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPEKQNCRSMDRFSFHSPSAQQRLRQWA
EEREATLNNSLMKLREQIVKANLLVREANYIAEELDKRTEYKVTLQIPASSLDANRKRGS
LLSEPAIQVRRKGKGKQIWSLEKLDNRLLDMRDLYQEWKECEEDNPVIRSYFKRADPFYD
EQENHSLIGVANVFLESLFYDVKLQYAVPIINQKGEVAGRLHVEVMRLSGDVGERIAGGD
EVAEVSFEKETQENKLVCMVKILQATGLPQHLSHFVFCKYSFWDQQEPVIVAPEVDTSSS
SVSKEPHCMVVFDHCNEFSVNITEDFIEHLSEGALAIEVYGHKINDPRKNPALWDLGIIQ
AKTRSLRDRWSEVTRKLEFWVQILEQNENGEYCPVEVISAKDVPTGGIFQLRQGQSRRVQ
VEVKSVQESGTLPLMEECILSVGIGCVKVRPLRAPRTHDTFHEEEEDMDSYQDRDLERLR
RKWLNALTKRQEYLDQQLQKLVSKRDKTEDDADREAQLLEMRLTLTEERNAVMVPSAGSG
IPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAGGWDATLTGEEEEEFFELQ
IVKQHDGEVKAEASWDSAVHGCPQLSRGTPADERLFLIVRVTVQLSHPADMQLVLRKRIC
VNVHGRQGFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQGVEEREALARMAANVENPA
SADSEAYIEKYLRSVLAVENLLTLDRLRQEVAVKEQLTGKGKLSRRSISSPNVNRLSGSR
QDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLN
PVKSFVPQMPKLLKSLFPVRDEKRGKRPSPLAHQPVPRIMVQSASPDIRVTRMEEAQPEM
GPDVLVQTMGAPALKICDKPAKVPSPPPVVAVTAVTPAPAPEAQDGPPSPLSEASSGYFS
HSVSTATLSDALGPGLDAAAPPGSMPTAPEAEPEAPISHPPPPTAVPAEEPPGPQQLVSP
GRERPDLEAPAPGSPFRVRRVRASELRSFSRMLAGDPGCSPGAEGRQALASDSEEADEVP
EWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGY
GLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNP
ENRKSWAS
Download sequence
Identical sequences ENSGGOP00000017048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]