SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017072 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017072
Domain Number 1 Region: 279-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-41
Family SPRY domain 0.00038
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000656
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017072   Gene: ENSGGOG00000028616   Transcript: ENSGGOT00000032867
Sequence length 452
Comment pep:known_by_projection chromosome:gorGor3.1:11:51946721:51954914:1 gene:ENSGGOG00000028616 transcript:ENSGGOT00000032867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGISQVFQRDLTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECIKTIQ
QRNLKTNIRLKKMASLARKASLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQE
HRYHRHCPAEWAAEEHWEKLLKKMQSLWEKACENQRNLNVETTRISHWKDYVNVRLEAIR
AEYQKMPAFHHEEEKHNLEVLEKKGKDIFHQLHSGKAKMSHRREILRGTYVELMKMCHKP
HVELLQAFGDILYRSESVQLHMPQLLNLELSAGPITGLRDRLNQFRVDIALYHNETNTHI
FRCGDLRSICIGCDRQNPPHITATPTSFLAWGAQTFTSGKYYWEVHVGDSWSWAFGVCNK
YWKGKNQSGNIYGEEGLFTTGCVKNDIQCSLFTTSPITLQYVPRPTNHVELFLDCEARTV
SFVDVNQSSPIYTISNCSFSPPLRPIFCCVLL
Download sequence
Identical sequences XP_004051141.1.27298 ENSGGOP00000007936 ENSGGOP00000017072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]