SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017143 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017143
Domain Number 1 Region: 188-317
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-36
Family Pleckstrin-homology domain (PH domain) 0.00000108
Further Details:      
 
Domain Number 2 Region: 467-573
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-24
Family SH2 domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 27-87
Classification Level Classification E-value
Superfamily Phenylalanine zipper 2.09e-22
Family Adapter protein APS, dimerisation domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017143   Gene: ENSGGOG00000016975   Transcript: ENSGGOT00000029702
Sequence length 616
Comment pep:known_by_projection chromosome:gorGor3.1:7:99852522:99873180:1 gene:ENSGGOG00000016975 transcript:ENSGGOT00000029702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGGPVMPLEQVTPSTPVLPPVPVPGPDWRQFCELHAQAAAVDFAHKFCRFLQDNPAYDT
PDAGASFSRHFAANFLDVFGEEVRRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGH
SRSSEDVSTHAATKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPSAE
PRDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVA
EERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETID
LQKHSWVADIQGCVDTGYPLPPIASRLCEACSMGPGPGDLEGSWTRSCLHPKRASEHWEL
GRDGSESPKETGRSGTMGAMAGPDPQSDCNPSSTAVRTICSANSFPSCCEGIVGRDHGPS
VGTVHSVIYLFVPLSPSPHVPHTVIPTSGEQGAETDPEAEPELELSDYPWFHGTLSRVKA
AQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSV
LDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPEPGPTPPASPASPACWSDSPGQHYS
NAAGASLSSASSSSAA
Download sequence
Identical sequences ENSGGOP00000017143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]