SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017293
Domain Number 1 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 291-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 347-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 190-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 245-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000064
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 152-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000122
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017293   Gene: ENSGGOG00000027529   Transcript: ENSGGOT00000025879
Sequence length 508
Comment pep:novel chromosome:gorGor3.1:19:21774190:21805546:1 gene:ENSGGOG00000027529 transcript:ENSGGOT00000025879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPGPPESLEMGPLTFRDVAIEFSLEEWQCLDTAQQDLYRKVMLENYRNLAFLGIAVSMPD
LVTCLQQGKDPWNVKRQSTVVKPPVVCSHFAQDLWPGLNIKDSFQKLIQRECGKCGHKDL
HLRKDCESVNECNVPKEGYNELNQCLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKK
TFKCKKCGKSFCMPLHLCQHKRIHIRENSHRCEECGKAFIWFSTLTRHRRVHTGEKSYKY
ECGKSFNRDSNLTTHKRIHTEECGKAFSVFSILTKHKIIHTEEKPYKCEERSSHITTHKR
IHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDEKPYKCEECGKAFNSSILSIHKKIHTGE
KPYKCEECGKTFKQSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYK
CEKCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEAC
GKAFRRSSHLSRHKIIHIGIYTEEIVQK
Download sequence
Identical sequences ENSGGOP00000017293 ENSGGOP00000017293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]