SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017367
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.39e-37
Family PSF2 C-terminal domain-like 0.000000542
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 8.6e-22
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017367   Gene: ENSGGOG00000009069   Transcript: ENSGGOT00000027661
Sequence length 185
Comment pep:known_by_projection chromosome:gorGor3.1:16:76240396:76253262:-1 gene:ENSGGOG00000009069 transcript:ENSGGOT00000027661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF
Download sequence
Identical sequences G3RNK0 H2NRP1 K7D3M4 Q9Y248
ENSP00000253462 2e9x_B 2e9x_F ENSP00000253462 gi|7706367|ref|NP_057179.1| ENSPPYP00000008593 ENSPPYP00000008593 2e9xB ENSP00000253462 GO.35208 9600.ENSPPYP00000008593 9606.ENSP00000253462 NP_057179.1.87134 NP_057179.1.92137 XP_002822898.1.23681 XP_002826768.1.23681 XP_004058140.1.27298 ENSGGOP00000008866 ENSGGOP00000017367 ENSGGOP00000008866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]