SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017520 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017520
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000112
Further Details:      
 
Domain Number 2 Region: 175-267
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000128
Further Details:      
 
Domain Number 3 Region: 369-460
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000148
Further Details:      
 
Domain Number 4 Region: 268-359
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017520   Gene: ENSGGOG00000027554   Transcript: ENSGGOT00000034104
Sequence length 639
Comment pep:known_by_projection chromosome:gorGor3.1:1:80231612:80263275:-1 gene:ENSGGOG00000027554 transcript:ENSGGOT00000034104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSTVPPPSSGSGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG
DQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQES
GCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEI
MIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM
VLELIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQ
FKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNM
GPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIR
GTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYN
PGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQ
PPPAAPAGAPTTTQTNGQVLLEQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPP
GGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
Download sequence
Identical sequences ENSGGOP00000017520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]