SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017550 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017550
Domain Number 1 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 7 Region: 111-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000136
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 415-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000351
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017550   Gene: ENSGGOG00000023756   Transcript: ENSGGOT00000027030
Sequence length 466
Comment pep:known_by_projection chromosome:gorGor3.1:19:20408129:20442537:-1 gene:ENSGGOG00000023756 transcript:ENSGGOT00000027030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLTFRDVTIEFSLEEWEFLNPAQQSLYRKVMLENYRNLVSLAMSSHYTEDLLPEQGMQ
DSFQKVILRRYGSCGLEDLHLRKDGENVGECKDQKEIYNGLNQCLSTLPSKIFPYNKCVK
VFSKSSNLNRENRRHTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCICEECGKTFKW
FSYLTKHKRIHTGEKPYKCEECGKAFNWCSSLTKHKRIHTGEKPYKCEECGKAFHWCSPF
VRHKKIHTGEKPYTCEDCGRAFNRHSHLTKHKTIHTGKKPYKCKECGKAFNHCSLLTIHE
RTHTGEKPYKCEECGKAFNSSSILTEHKVIHSGEKPYKCEKCDKVFKRFSYLTKHKRIHT
GEKPYKCEECGKAFNWSSILTEHKRIHTGEKPYNCEECGKAFNRCSHLTRHKKIHTAVKR
YKCEECGKAFKRCSHLNEHKRVERGDKSCKYKKCGEAFNHCSNLTT
Download sequence
Identical sequences ENSGGOP00000017550 ENSGGOP00000017550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]