SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017567 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017567
Domain Number 1 Region: 210-493
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000505
Further Details:      
 
Domain Number 2 Region: 497-783
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017567   Gene: ENSGGOG00000005074   Transcript: ENSGGOT00000023847
Sequence length 793
Comment pep:known_by_projection chromosome:gorGor3.1:20:2975466:3075726:1 gene:ENSGGOG00000005074 transcript:ENSGGOT00000023847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSAAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTTATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALP
ACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQEKNK
FIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKA
CNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDM
QYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGP
LLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECE
SYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQ
EYIDAFSDYANFK
Download sequence
Identical sequences G3RP48
ENSGGOP00000017567 XP_018872543.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]