SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017649
Domain Number 1 Region: 146-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.02e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017649   Gene: ENSGGOG00000008633   Transcript: ENSGGOT00000033959
Sequence length 433
Comment pep:known_by_projection chromosome:gorGor3.1:1:33099237:33130106:1 gene:ENSGGOG00000008633 transcript:ENSGGOT00000033959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGTQPPPLLPPS
ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIE
KIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEE
TGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEE
VKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPR
GALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYG
YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARP
VKGAYREHPYGRY
Download sequence
Identical sequences ENSGGOP00000017649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]