SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017679 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017679
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.4e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 158-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000122
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 242-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000156
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017679   Gene: ENSGGOG00000022914   Transcript: ENSGGOT00000029842
Sequence length 378
Comment pep:known_by_projection chromosome:gorGor3.1:1:41974133:41990656:1 gene:ENSGGOG00000022914 transcript:ENSGGOT00000029842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISFQESVTFQDVAVDFTAEEWQLLDCAERTLYWDVMLENYRNLISVGCPITKTKVILKV
EQGQEPWMVEGVNPHESSPESDYPLVDEPGTHRESKDNFLKSVLLTFNKILTMERIHHYN
MSTSLNPMRKKSYKLFEKCLPPNLDLLKYNRSYTVENAYECSECGKAFKKKFHFIRHEKN
HTRKKPFECNDCGKAYSRKAHLVTHQKIHNGERPFVCNDCGKAFMHKAQLVVHQRLHTGE
KPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRFHTGEKPYQ
CIICGKAFGNTSVLVTHQRIHTGEKPYRCIECGKAFIKKSHLLRHQITHTGEKPYECNRC
GKAFSQKSNLIVHQKIHI
Download sequence
Identical sequences G3S951
ENSGGOP00000017679 XP_004025594.1.27298 XP_018871888.1.27298 XP_018871897.1.27298 ENSGGOP00000017679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]