SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017680 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017680
Domain Number 1 Region: 23-157,219-477
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 6.67e-111
Family Proton glutamate symport protein 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017680   Gene: ENSGGOG00000005646   Transcript: ENSGGOT00000026438
Sequence length 562
Comment pep:known_by_projection chromosome:gorGor3.1:1:54774809:54832966:-1 gene:ENSGGOG00000005646 transcript:ENSGGOT00000026438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAMVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRHLSPQEISYFQFPGELLM
RMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGS
AAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAP
PRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGR
MGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSV
TVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLEN
NHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIG
AAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICR
KDFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPACPHHVPVQVEQD
EELPAASLNHCTIQISELETNV
Download sequence
Identical sequences ENSGGOP00000017680 ENSGGOP00000005532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]