SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018010 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018010
Domain Number 1 Region: 1466-1692
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-42
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 635-739
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-29
Family Cadherin 0.00051
Further Details:      
 
Domain Number 3 Region: 530-642
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 925-1037
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.00091
Further Details:      
 
Domain Number 5 Region: 313-416
Classification Level Classification E-value
Superfamily Cadherin-like 3e-25
Family Cadherin 0.00094
Further Details:      
 
Domain Number 6 Region: 1709-1919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-24
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 7 Region: 1031-1131
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 8 Region: 418-528
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 735-855
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 10 Region: 852-931
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-16
Family Cadherin 0.0047
Further Details:      
 
Domain Number 11 Region: 1405-1445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000233
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 1133-1235
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1953-1999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1917-1951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000024
Family EGF-type module 0.024
Further Details:      
 
Domain Number 15 Region: 2047-2086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000829
Family Laminin-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018010
Domain Number - Region: 2508-2751
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000412
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number - Region: 2075-2149
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00288
Family Hormone receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 1386-1409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00749
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018010   Gene: ENSGGOG00000016683   Transcript: ENSGGOT00000031696
Sequence length 3260
Comment pep:known_by_projection chromosome:gorGor3.1:3:49883519:49908731:-1 gene:ENSGGOG00000016683 transcript:ENSGGOT00000031696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPRSRWCPLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGAL
ALCPESSGVREDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPSGSR
ERETGQGPGSVLYWRSEVSSCGRTGPLQRGSLSPGALSSGVPGLGNSSPLPSDFLVRHHG
PKLVSSQRNAGTGSRKRVGTARCCGELWATGSKGQGERATTSGAERTAPRRNCLPGASGS
GPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRGLFRRRFLPRLPARPEARKITS
ANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMN
SRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDH
SPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEID
PRSGLISTSGQVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKR
YVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLD
FEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLGHS
VIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVEHYFFGVEAR
DHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDANSAI
SYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDHCYVHINIT
DANTHRPVFQSAHYYDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLA
ITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDA
HANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTP
VSFQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGN
IPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSPVLN
NFQILFNNYVSNRSDTFPSGIIGRIPAYDPDVSDHLFYSFERGNELQLLVVNQTSGELRL
SRKLDNNRPLVASMLVTVTDGLHSVTAQCVLRVVIITEELLANSLTVRLENMWQERFLSP
LLGRFLEGVAAVLATPAEDVFIFNIQNDTDVGGTVLNVSFSALAPRGAGAGAAGPWFSSE
ELQEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDSSAPFLASASTLF
RPIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRNGGACARREGGYTCVCRPRFTGEDC
ELDTEAGRCVPGVCRNGGTCTDAPNGGFRCQCPAGGAFEGPRCEVAARSFPPSSFVMFRG
LRQRFHLTLSLSFATVQQSGLLFYNGRLNEKHDFLALELVAGQVRLTYSTGESNTVVSPT
VPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDKVAVLSVDDCDVAVALQFGAEIGNY
SCAAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPVSHKDFIGCMRDLHIDGRRVDMAAFV
ANNGTMAGCQAKLHFCDSGPCKNSGFCLERWGGFSCDCPVGFGGKDCRLTMAHPHHFRGN
GTLSWNFGSDMAVSVPWYLGLAFRTRATQGVLMQVQAGPHSTLLCQLDRGLLSVTVTRGS
GRASHLLLDQVTVSDGRWHDLRLELQEEPGGRRGHHVLMVSLDFSLFQDTMAVGSELQGL
KVKQLHVGGLPPGSAEEAPQGLVGCIQGVWLGSTPSGSPALLPPSHRVNVEPGCVVTNAC
ASGPCPPHADCRDHWQTFSCTCRPGYYGPGCVDACLLNPCQNQGSCRHLPGAPHGYTCDC
VGGYFGHHCEHRMDQQCPRGWWGSPTCGPCNCDVHKGFDPNCNKTNGQCHCKEFHYRPRG
SDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDSPFAEVTASGCRVLYDACP
KSLRSGVWWPQTKFGILATVPCPRGALGAAVRLCDEAQGWLEPDLFNCTSPAFRELSLLL
DGLELNKTALDTMEAKKLAQRLREVTGHTDHYFSQDVRVTARLLAHLLAFESHQQGFGLT
ATQDAHFNENLLWAGSALLAPETGDLWAALGQRAPGGSPGSAGLVRHLEEYAATLARNME
LTYLNPMGLVTPNIMLSIDRMEHPSSPRGARRYPRYHSNLFRGQDAWDPHTHVLLPSQSP
RPSPSEVLPTSSSTENSTTSSVVPPPAPPEPEPGISIIILLVYRTLGGLLPAQFQAERRG
ARLPQNPVMNSPVVSVAVFHGRNFLRGILESPISLEFRLLQTANRSKAICVQWDPPGLAE
QHGVWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRERLEGDLELLAVFTHVVVAVS
VAALVLTAAVLLSLRSLKSNVRGIHANVAAALGVAELLFLLGIHRTHNQLVCTAVAILLH
YFFLSTFAWLFVQGLHLYRMQVEPRNVDRGAMRFYHALGWGVPAVLLGLAVGLDPEGYGN
PDFCWISVHEPLIWSFAGPVVLVIVMNGTMFLLAARTSCSTGQREAKKTSALTLRSSFLL
LLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGLAVLLLFCVLNADARAAWTPACLGRK
AAPEEARPAPGMGPGAYNNTALFEESGLIRITLGASTVSSVSSTRSGRTQDQDSQRGRSY
LRDNVLVRHGSAADHTDHSLQAHAGPTDLDVAMFHRDAGADSDSDSDLSLEEERSLSIPS
SESEDNGRTRGRFQRPLCRAAQSERLLTHPKDVDGNDLLSYWPALGECEAAPCALQTWGS
ERRLGLDTSKDAANNNQPDPALTSGDETSLGRAQRQRKGILKNRLQYPLVPQTRGAPELS
WCRAATLGQPPSRYSSREQLDLLLRRQLSRERLEEAPAPVLRPLSRPGSQECMDAAPGRL
EPRDRGSTLPRRQPPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPRRTRDLDPQPPPL
PLSPQRQLSRDPLLPSRPLDSLSRSSNSREQLDQVPSRHPSREALGPPPQLLRAREDPVS
GPSHGPSTEQLDILSSILASFNSSALSSVQSSSTPLGPHTTATPSATASVLGPSTPRSAT
SHSISELSPDSEVPRSEGHS
Download sequence
Identical sequences ENSGGOP00000018010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]