SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018071 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018071
Domain Number 1 Region: 970-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-81
Family Protein kinases, catalytic subunit 0.0000000000659
Further Details:      
 
Domain Number 2 Region: 1-161
Classification Level Classification E-value
Superfamily L domain-like 2.44e-43
Family L domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 344-469
Classification Level Classification E-value
Superfamily L domain-like 7.37e-39
Family L domain 0.000000539
Further Details:      
 
Domain Number 4 Region: 466-589
Classification Level Classification E-value
Superfamily Fibronectin type III 2.73e-33
Family Fibronectin type III 0.000000141
Further Details:      
 
Domain Number 5 Region: 776-918
Classification Level Classification E-value
Superfamily Fibronectin type III 6.6e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 6 Region: 593-656,782-806
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-17
Family Fibronectin type III 0.0000431
Further Details:      
 
Domain Number 7 Region: 146-292
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.0000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018071   Gene: ENSGGOG00000013703   Transcript: ENSGGOT00000034031
Sequence length 1356
Comment pep:known_by_projection chromosome:gorGor3.1:19:7306086:7463723:-1 gene:ENSGGOG00000013703 transcript:ENSGGOT00000034031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRV
YGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELC
YLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHS
HCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYY
HFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSKLSDATFAP
CFGPGLGVCGNLQKKKYFVSASAVLPLPGCCYILLNRSLWCGKGGYNLAAELEANLGLIE
EISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTIT
QGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSF
DKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSND
PKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPI
SVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKXLEXPSNSEGKSI
CSDVYQCYSSQQTFLPEPPVCKNPKKNSARLGEVAEPSLGRIFSDFFPFPCWTPAPAGKT
SSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKES
LVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEEKADDIVGPVTHEIFENNV
VHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVR
ATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDG
PLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDII
KGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELM
AHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM
VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVL
WEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEI
VNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGG
SSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
Download sequence
Identical sequences ENSGGOP00000013375 ENSGGOP00000018071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]