SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018094 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018094
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-30
Family Ras-binding domain, RBD 0.00083
Further Details:      
 
Domain Number 3 Region: 215-372
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-22
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 4 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 7.99e-21
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000172
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018094   Gene: ENSGGOG00000003385   Transcript: ENSGGOT00000027501
Sequence length 1372
Comment pep:known_by_projection chromosome:gorGor3.1:4:3354471:3492816:1 gene:ENSGGOG00000003385 transcript:ENSGGOT00000027501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRAGEASKRPLPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAATRFD
VGHESINNLNPNMLSEEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDP
EGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHASDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQSPLSAPKR
EWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGTGLTQPSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLSGLLVRLSG
EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASTDKQKGVPVKQSTAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEVEFFELISKAQS
NRADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKDFSKRSATDNGRESASQPGE
QWEPAPESSDSPSTSPGSAPSPPGPPGTTPPGRSLPAGPSPVSPAQEGTVQIWKRQSQEA
EAGGIQTVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQDVPGPSRPGTSRF
Download sequence
Identical sequences ENSGGOP00000018094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]