SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018199 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018199
Domain Number 1 Region: 68-261
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.26e-41
Family Nuclear receptor ligand-binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 20-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.04e-25
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018199   Gene: ENSGGOG00000008656   Transcript: ENSGGOT00000033667
Sequence length 262
Comment pep:known_by_projection chromosome:gorGor3.1:15:76289689:76292028:1 gene:ENSGGOG00000008656 transcript:ENSGGOT00000033667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAAGGQGGPGGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCR
ANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPDPADTGSALTNGDPLNCHSYL
SGYISLLLRAEPYPTSRFGACSPTTMGIENICELAARMLFSAVEWARNIPFFPDLQITDQ
VALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEK
LKALHVDSAEYSCLKAIVLFTS
Download sequence
Identical sequences ENSGGOP00000018199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]