SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018228 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018228
Domain Number 1 Region: 315-404
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.72e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 141-193
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000596
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 36-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000772
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018228   Gene: ENSGGOG00000022941   Transcript: ENSGGOT00000022600
Sequence length 852
Comment pep:known_by_projection chromosome:gorGor3.1:14:14232592:15002011:1 gene:ENSGGOG00000022941 transcript:ENSGGOT00000022600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKL
LPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRRS
PSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDY
VHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDN
TLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHA
LPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEG
IRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPE
YKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPE
PDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDRFGALGPMQIKV
ERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRRRL
SSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISRNE
SPYSMTKPPSSEHFPSPQGGGGGGGGGGGGGCVAIPDSSSPRPADGADLEALQRLQAGNV
VLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQSNLLPNAHAVNFVDVNSPGF
GLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTLPFPVYSNG
IHAAQTLERKED
Download sequence
Identical sequences ENSGGOP00000018228 ENSGGOP00000018228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]