SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018234 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018234
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 228-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.21e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 376-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 102-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000443
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018234   Gene: ENSGGOG00000023307   Transcript: ENSGGOT00000025656
Sequence length 436
Comment pep:known_by_projection chromosome:gorGor3.1:10:41380134:41399682:-1 gene:ENSGGOG00000023307 transcript:ENSGGOT00000025656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFRGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKL
KQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTRTTDKACEC
KECGKFFCQKSALIVHQHTHSKGKSYDCDKCGKSFSKNEDLIRHQKIHTRDKTYECKECK
KIFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLIEHQKTHTGEHQKTHTGEKPYEC
KECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRNSHLKTHQRTHTGEKPYECKECR
KCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKHQRKHTGEKPYECTQCGKSFA
VNSVLRLHQRTHTGEKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQ
LTAHQKTHTKKRKAEK
Download sequence
Identical sequences ENSGGOP00000018234 ENSGGOP00000018234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]