SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018365 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018365
Domain Number 1 Region: 194-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family SPRY domain 0.00062
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.02e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 86-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000733
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018365   Gene: ENSGGOG00000028469   Transcript: ENSGGOT00000031184
Sequence length 367
Comment pep:novel chromosome:gorGor3.1:11:51975856:51982069:-1 gene:ENSGGOG00000028469 transcript:ENSGGOT00000031184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELSCPICMNYFLDPVTIDCGHSFCRPCFYLNWQDMEVVAQCSKCKKTTW
QRNLNTDICLKNMASIARKASLRQFLSSEEQICGMHRETKKMFCEVDKSPLCLLCSNSQE
HRNHRHCPIEWAAEERRILSDFIKQFNESSAKPKYMATKSTRGSQREKGYESLLLQVSEP
VNPEFSAGPITGLMDRLKGFRVYLTLQHARANSHIFLHGDLRSMKVGCDPQDDPNITDKS
ECFLQWGADFFISGKFYWEFNMGHSWNWAFGDCNNYWKEKRQNDMIDGEVGLFLLGCVKE
DTHCSLFTTSPLVMQYVPRPTDTVGLFLDCEGRTVSFVDVDRSSLIYTIPNCSFSPPLWP
IICCSHF
Download sequence
Identical sequences ENSGGOP00000018365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]