SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018400 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018400
Domain Number 1 Region: 57-267
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000209
Family Glycerol-3-phosphate (1)-acyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018400   Gene: ENSGGOG00000024997   Transcript: ENSGGOT00000029893
Sequence length 414
Comment pep:known_by_projection chromosome:gorGor3.1:2a:31015394:31204358:1 gene:ENSGGOG00000024997 transcript:ENSGGOT00000029893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSRGREIVVPLNPWSINEAVSSYCTYFIKQDSKSFGIMMSWKGIYFILTLFWGSFFGSI
FMLGPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVII
MNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKS
HFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTF
VVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL
QLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELRVLVVKLLSILYWTLFSPAM
CLLIYLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Download sequence
Identical sequences A0A2I2YN45
ENSGGOP00000018599 ENSGGOP00000018400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]