SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018479 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018479
Domain Number 1 Region: 288-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-44
Family SPRY domain 0.0000779
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 9.66e-17
Family RING finger domain, C3HC4 0.0098
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000534
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018479   Gene: ENSGGOG00000027897   Transcript: ENSGGOT00000029927
Sequence length 453
Comment pep:novel chromosome:gorGor3.1:11:49765523:49771908:-1 gene:ENSGGOG00000027897 transcript:ENSGGOT00000029927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLRVFQNELICCICVNYFIDPVTTDCGHSFCRPCLCLCSEEGRAPMCCPLCRKISE
KPNFNTNVALKKLASLARQTRPQNINSSDNICVLHEETKELFCEADKRLLCGPCSESSEH
MAHSHSPIGWAAEECREKLIKEMDYLWKINRETQNNLNQETSKFCSLVDYVSLRNVIITI
QYQKMHIFLDKEEQRHLQALGREAKELFQQLEDSQVRMTQHLEGMKDMYRELWETCHMPD
VELLQVRAHFFLMPTDEAFHCLVEVLLLTFLQDVGNISARPQRHLVTRRRANELSVDNAL
STEMTPCYISLSEDVRRVIFGDDHRSAPMDPQGVESFAVCAQAFTSGKHYWEVDVTNSSN
WILGVCRDSRTADTNIIIDDKTFFSISSKTSNHYSLSTNSPPLIQYVQRPLGWVGVFLDY
DNGSVSFFDVSKGSLIYGFPPSSFSSPLRPFFC
Download sequence
Identical sequences ENSGGOP00000023200 ENSGGOP00000018479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]