SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018533 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018533
Domain Number 1 Region: 16-177,279-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.26e-42
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018533   Gene: ENSGGOG00000013897   Transcript: ENSGGOT00000031812
Sequence length 483
Comment pep:known_by_projection chromosome:gorGor3.1:1:221905381:221949237:1 gene:ENSGGOG00000013897 transcript:ENSGGOT00000031812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFILLLKIPYICGIKVGSLQACFLAKRHFQIDVYEAREDTRVATFTRGRSINLALSHRGR
QALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAE
KYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRF
DYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEE
FEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLG
DAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSLCLPVFSRLRIPDDHAISDLSMYN
YIEMRAHVNSSWFIFQKNMERFLHTIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVIN
KGLFFLGSLIAISSTYLLIHYMSPRPFLRLRRPWNWIAHFRNTTCFPAKAMDSLEQISNL
ISR
Download sequence
Identical sequences ENSGGOP00000018533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]