SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018599 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018599
Domain Number 1 Region: 23-229
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000183
Family Glycerol-3-phosphate (1)-acyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018599   Gene: ENSGGOG00000024997   Transcript: ENSGGOT00000034695
Sequence length 377
Comment pep:known_by_projection chromosome:gorGor3.1:2a:31003386:31204358:1 gene:ENSGGOG00000024997 transcript:ENSGGOT00000034695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMMSWKGIYFILTLFWGSFFGSIFMLGPFLPLMFVNPSWYRWINNRLVATWLTLPVALLE
TMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKGVP
GFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNA
FAEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDF
PREIHFHVHRYPIDTLPTSKEDLQLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCK
SELRVLVVKLLSILYWTLFSPAMCLLIYLYSLVKWYFIITIVIFVLQERIFGGLEIIELA
CYRLLHKQPHLNSKKNE
Download sequence
Identical sequences ENSGGOP00000018599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]