SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018719 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018719
Domain Number 1 Region: 1215-1319,1376-1529
Classification Level Classification E-value
Superfamily Cullin homology domain 2.49e-40
Family Cullin homology domain 0.00045
Further Details:      
 
Domain Number 2 Region: 778-970
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-35
Family APC10-like 0.0055
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-32
Family CPH domain 0.00000606
Further Details:      
 
Domain Number 4 Region: 119-195,473-562,640-810
Classification Level Classification E-value
Superfamily ARM repeat 0.0000023
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018719
Domain Number - Region: 1539-1635
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0141
Family Penicillinase repressor 0.036
Further Details:      
 
Domain Number - Region: 962-1071
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0602
Family Cullin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018719   Gene: ENSGGOG00000010532   Transcript: ENSGGOT00000033087
Sequence length 1687
Comment pep:known_by_projection chromosome:gorGor3.1:6:44294723:44310918:-1 gene:ENSGGOG00000010532 transcript:ENSGGOT00000033087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDC
KAEHILLWMSKDEIYANCHKMLDEDGQVIGPSQESVGEVGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGAQNTSAPEELSGERGQLELEFSMAM
GTLISELVQAMRWDQASDRPRSSARSSSSIFQPQLADVSPGRPAAQAQPSFRRSRRFRPR
SEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGKFRQSNNGVPPVQVFWESTGRT
YWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLGRALPAWRWRPMTELYAVPYVLPED
EDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELA
QDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDVLLLEAQAQAKD
SEDAAKAEAKEPPSQSPNTPLQRLVEGYGPAGKILLDLEQALSSEGTQENKVKPLLLQLK
RQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDFPEALLLPWHEAVDACMACLRSPNT
DREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCE
KHAHLYRKLITNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSVEVKEDKC
WEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYITLHMRQGILIRQLTLLVASEDSSY
MPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTR
IRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDMAEDRRSLLHLSSRLNGALRQ
EQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITSPDEDGISPLGWLLDQYLECQEAVF
NPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATPRPKGRNRSHDWSSLATRGLPSSIM
RNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHFNILQNSSSELFGPRAAFLLALQNG
CAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGAQEMERLAQLQQCLQAVLIFSGLEI
ATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSKELQRQFHV
YQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKEEEAGAAAVVDVDLYYEGAMPEVSV
LVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWL
GWAELQFGNQTLHVSTMQMWLLLYLNDLKAVSVESLLALSGLSADMLNQAIGPLTSSRGP
LDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEEGRNLEKRRNLLNCLI
VRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGK
GTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTAT
QSFSTFR
Download sequence
Identical sequences ENSGGOP00000018719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]